PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.2579s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family NF-YA
Protein Properties Length: 224aa    MW: 24446.4 Da    PI: 10.4671
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.2579s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA95.94.4e-3085141158
            CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                          d p+YVNaKQy++I++RR  Rak+e  kk  +++rkpy+heSRh hA+rRpRg+gGrF
  Kalax.2579s0001.1.p  85 DGPIYVNAKQYHGIIRRRLYRAKAELVKKS-IRARKPYMHESRHLHAMRRPRGCGGRF 141
                          57************************9999.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.3E-3383144IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115234.65584144IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006164.4E-2387109IPR001289Nuclear transcription factor Y subunit A
PfamPF020458.7E-2787141IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS00686089109IPR018362CCAAT-binding factor, conserved site
PRINTSPR006164.4E-23118141IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
GAGKGGSTQF TISTGGERNQ HVRASITVQP TLPDYQSHLE SGFGQAMVYS KYPYGDQSYS  60
VMSTYGPQVA VQGRVMLPLD MTSDDGPIYV NAKQYHGIIR RRLYRAKAEL VKKSIRARKP  120
YMHESRHLHA MRRPRGCGGR FLNTKISDAG MGGNSMKSTS NGLLTQPTGS PSSGIFQSDS  180
GTLNSPKQSN SDMSHISGSE ATSMYTRGDL RRFTTNFLSH SLPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_A6e-1885142260HAPB protein
4g92_A6e-1885142260HAPB protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002263793.12e-85PREDICTED: nuclear transcription factor Y subunit A-10-like isoform X1
RefseqXP_010653262.12e-85PREDICTED: nuclear transcription factor Y subunit A-10-like isoform X1
TrEMBLF6I3K72e-85F6I3K7_VITVI; Putative uncharacterized protein
STRINGVIT_08s0032g01190.t016e-85(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.23e-51nuclear factor Y, subunit A10